Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B (TIMM10B)
Product Specifications
Product Name Alternative
Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B ; Tim10b
Abbreviation
Recombinant Human TIMM10B protein
Gene Name
TIMM10B
UniProt
Q9Y5J6
Expression Region
1-103aa
Organism
Homo sapiens (Human)
Target Sequence
MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Signal Transduction
Relevance
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmbrane proteins into the mitochondrial inner mbrane. The TIM22 complex forms a twin-pore translocase that uses the mbrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70KDA complex that guides the target proteins in transit through the aqueous mitochondrial intermbrane space.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as the external driving force. In the TIM22 complex, it may act as a docking point for the soluble 70 kDa complex that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.
Molecular Weight
27.6 kDa
References & Citations
Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.Muehlenbein N., Hofmann S., Rothbauer U., Bauer M.F.J. Biol. Chem. 279:13540-13546 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog