Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26KDA protein ; CORS26Secretory protein CORS26

Abbreviation

Recombinant Human C1QTNF3 protein

Gene Name

C1QTNF3

UniProt

Q9BXJ4

Expression Region

23-246aa

Organism

Homo sapiens (Human)

Target Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.2 kDa

References & Citations

Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HIST1H2BN, NT (HIST1H2BN, H2BFD, Histone H2B type 1-N, Histone H2B.d) (FITC)
MBS6306838-01 0.2 mL

HIST1H2BN, NT (HIST1H2BN, H2BFD, Histone H2B type 1-N, Histone H2B.d) (FITC)

Ask
View Details
HIST1H2BN, NT (HIST1H2BN, H2BFD, Histone H2B type 1-N, Histone H2B.d) (FITC)
MBS6306838-02 5x 0.2 mL

HIST1H2BN, NT (HIST1H2BN, H2BFD, Histone H2B type 1-N, Histone H2B.d) (FITC)

Ask
View Details
Enterobacteriaceae Enrichment (EE) Broth (Harmonized)
RDM-H-EEB-01 500 g

Enterobacteriaceae Enrichment (EE) Broth (Harmonized)

Ask
View Details
Apolipoprotein A-II (Apo A-II) (MaxLight 650)
MBS6463649-01 0.1 mL

Apolipoprotein A-II (Apo A-II) (MaxLight 650)

Ask
View Details
Apolipoprotein A-II (Apo A-II) (MaxLight 650)
MBS6463649-02 5x 0.1 mL

Apolipoprotein A-II (Apo A-II) (MaxLight 650)

Ask
View Details
MOTOR BASE and CONTROL, Single Jaw Coupling From Motor to Sealed Bearing Shaft, DC Motor, Black ABS Enclosurewith Black Anodized Aluminum Base, 120/220 Volts, 50/60 Hz, CE Compliant, Powers VP 758A-5 Series Series Bubble Paddle Reservoirs, Screws Included for Robot Integration, SLAS Adaptor Deck (VP 581B) Sold Separately
VP 767A-5A 1 EACH

MOTOR BASE and CONTROL, Single Jaw Coupling From Motor to Sealed Bearing Shaft, DC Motor, Black ABS Enclosurewith Black Anodized Aluminum Base, 120/220 Volts, 50/60 Hz, CE Compliant, Powers VP 758A-5 Series Series Bubble Paddle Reservoirs, Screws Included for Robot Integration, SLAS Adaptor Deck (VP 581B) Sold Separately

Ask
View Details