Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Delta-like protein 3 (DLL3), partial

Product Specifications

Product Name Alternative

Drosophila Delta homolog 3 ; Delta3

Abbreviation

Recombinant Human DLL3 protein, partial

Gene Name

DLL3

UniProt

Q9NYJ7

Expression Region

27-492aa

Organism

Homo sapiens (Human)

Target Sequence

AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Developmental Biology

Relevance

Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm (By similarity) .

Molecular Weight

64.5 kDa

References & Citations

Mutations in the human delta homologue, DLL3, cause axial skeletal defects in spondylocostal dysostosis.Bulman M.P., Kusumi K., Frayling T.M., McKeown C., Garrett C., Lander E.S., Krumlauf R., Hattersley A.T., Ellard S., Turnpenny P.D.Nat. Genet. 24:438-441 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL
BNC742301-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ponatinib
SIH-588-25MG 25 mg

Ponatinib

Sign In for Pricing
View Details
Sec31a Mouse Gene Knockout Kit (CRISPR)
KN515467 1 Kit

Sec31a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexokinase Type III (HK3) (NM_002115) Human Over-expression Lysate
LC419533 20 µg

Hexokinase Type III (HK3) (NM_002115) Human Over-expression Lysate

Sign In for Pricing
View Details
Cystatin A (CSTA/2882), CF640R conjugate, 0.1mg/mL
BNC402882-100 1x 100 µL

Cystatin A (CSTA/2882), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MAB21L4 activation kit by CRISPRa
GA112729 1 Kit

Human MAB21L4 activation kit by CRISPRa

Sign In for Pricing
View Details