Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DGCR6L (DGCR6L)

Product Specifications

Product Name Alternative

DiGeorge syndrome critical region 6-like protein

Abbreviation

Recombinant Human DGCR6L protein

Gene Name

DGCR6L

UniProt

Q9BY27

Expression Region

1-220aa

Organism

Homo sapiens (Human)

Target Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Molecular Weight

40.9 kDa

References & Citations

Two functional copies of the DGCR6 gene are present on human chromosome 22q11 due to a duplication of an ancestral locus.Edelmann L., Stankiewicz P., Spiteri E., Pandita R.K., Shaffer L., Lupski J., Morrow B.E.Genome Res. 11:208-217 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®740 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20990-50uL 1x 50 µL

CF®740 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
Septin 8 (SEPT8) (NM_001300799) Human Tagged ORF Clone
RG238166 10 µg

Septin 8 (SEPT8) (NM_001300799) Human Tagged ORF Clone

Sign In for Pricing
View Details
Grin2a Mouse Monoclonal Antibody [Clone ID: N327/95]
75-288 100 µL

Grin2a Mouse Monoclonal Antibody [Clone ID: N327/95]

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561759 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
SLC24A6 Antibody
8C18851-AAT 50 µg

SLC24A6 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714051 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details