Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein DGCR6L (DGCR6L)

Product Specifications

Product Name Alternative

DiGeorge syndrome critical region 6-like protein

Abbreviation

Recombinant Human DGCR6L protein

Gene Name

DGCR6L

UniProt

Q9BY27

Expression Region

1-220aa

Organism

Homo sapiens (Human)

Target Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.

Molecular Weight

40.9 kDa

References & Citations

Two functional copies of the DGCR6 gene are present on human chromosome 22q11 due to a duplication of an ancestral locus.Edelmann L., Stankiewicz P., Spiteri E., Pandita R.K., Shaffer L., Lupski J., Morrow B.E.Genome Res. 11:208-217 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]
TA802439BM 100 µL

CD5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G10]

Sign In for Pricing
View Details
Human AHCYL2 activation kit by CRISPRa
GA108265 1 Kit

Human AHCYL2 activation kit by CRISPRa

Sign In for Pricing
View Details
TyraMaxTM 680/700 Amplification Dye, 100X
#96143-100UL 1x 100 µL

TyraMaxTM 680/700 Amplification Dye, 100X

Sign In for Pricing
View Details
APC Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832E-01 20 Tests

APC Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
APC Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832E-02 100 Tests

APC Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
APC Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832E-03 2x 100 Tests

APC Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details