Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Xaa-Pro aminopeptidase 1 (XPNPEP1)

Product Specifications

Product Name Alternative

Aminoacylproline aminopeptidaseCytosolic aminopeptidase PSoluble aminopeptidase P ; sAmpX-Pro aminopeptidase 1X-prolyl aminopeptidase 1, soluble

Abbreviation

Recombinant Human XPNPEP1 protein

Gene Name

XPNPEP1

UniProt

Q9NQW7

Expression Region

2-623aa

Organism

Homo sapiens (Human)

Target Sequence

PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Metabolism

Relevance

Contributes to the degradation of bradykinin. Catalyzes the roval of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.

Molecular Weight

85.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IER5 (NM_016545) Human Tagged ORF Clone
RC210318 10 µg

IER5 (NM_016545) Human Tagged ORF Clone

Sign In for Pricing
View Details
Kinesin 2C (KIF2C, Kinesein Family Member 2C, Kinesin-Like Protein 6, KNSL6, Kinesin-like Protein KIF2C, Mitotic Centromere-Associated Kinesin, MCAK, 4930402F02Rik, ESTM5, MGC11883, OTTHUMP00000010066, X83316) (FITC)
128828-FITC 100 µL

Kinesin 2C (KIF2C, Kinesein Family Member 2C, Kinesin-Like Protein 6, KNSL6, Kinesin-like Protein KIF2C, Mitotic Centromere-Associated Kinesin, MCAK, 4930402F02Rik, ESTM5, MGC11883, OTTHUMP00000010066, X83316) (FITC)

Sign In for Pricing
View Details
M-3M3FBS, Phospholipase C activator
TBI2718-50MG 50 mg

M-3M3FBS, Phospholipase C activator

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
MBS125499-01 0.02 mL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
MBS125499-02 0.1 mL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details
WNT3A Polyclonal Antibody
MBS125499-03 5x 0.1 mL

WNT3A Polyclonal Antibody

Sign In for Pricing
View Details