Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL)

Product Specifications

Product Name Alternative

Protease IVPvdS-regulated endoprotease

Abbreviation

Recombinant Pseudomonas aeruginosa prpL protein

Gene Name

PrpL

UniProt

Q9HWK6

Expression Region

212-462aa

Organism

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Target Sequence

AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Lysine-specific endoprotease . Involved in corneal virulence.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lysine-specific endoprotease

Molecular Weight

42.4 kDa

References & Citations

Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2E1 (NM_001286102) Human Tagged ORF Clone
RG238134 10 µg

NR2E1 (NM_001286102) Human Tagged ORF Clone

Sign In for Pricing
View Details
RBM22 CRISPRa sgRNA lentivector (set of three targets)(Rat)
38607126 3x 1.0µg DNA

RBM22 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Human C1q/TNF-related protein-3, Cartonectin/CTRP3/CORS-26 ELISA Kit
YLA0593HU-01 48 Tests

Human C1q/TNF-related protein-3, Cartonectin/CTRP3/CORS-26 ELISA Kit

Sign In for Pricing
View Details
Human C1q/TNF-related protein-3, Cartonectin/CTRP3/CORS-26 ELISA Kit
YLA0593HU-02 96 Tests

Human C1q/TNF-related protein-3, Cartonectin/CTRP3/CORS-26 ELISA Kit

Sign In for Pricing
View Details
Acrp30, CT (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (Not for Export EU)
A0725-05 100 µL

Acrp30, CT (Adipocyte Complement-related Protein of 30kD, Adiponectin, AdipoQ, apM1, Gelatin Binding Protein 28, GPB28) (Not for Export EU)

Sign In for Pricing
View Details
DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (MaxLight 490)
MBS6292889-01 0.1 mL

DNAJC6, ID (DNAJC6, KIAA0473, Putative tyrosine-protein phosphatase auxilin, DnaJ homolog subfamily C member 6) (MaxLight 490)

Sign In for Pricing
View Details