Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL)

Product Specifications

Product Name Alternative

Protease IVPvdS-regulated endoprotease

Abbreviation

Recombinant Pseudomonas aeruginosa prpL protein

Gene Name

PrpL

UniProt

Q9HWK6

Expression Region

212-462aa

Organism

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Target Sequence

AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Lysine-specific endoprotease . Involved in corneal virulence.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lysine-specific endoprotease

Molecular Weight

42.4 kDa

References & Citations

Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMI1 Protein Lysate (Mouse) with C-HA Tag
39633035 100 µg

RMI1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal Coagulation Factor III/Tissue Factor Antibody (HTF-1) [Alexa Fluor 594]
NBP2-62199AF594 0.1 mL

Mouse Monoclonal Coagulation Factor III/Tissue Factor Antibody (HTF-1) [Alexa Fluor 594]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Soft tissue
CB615470 1 Block

Frozen Tissue Blocks, Soft tissue

Sign In for Pricing
View Details
Human Tribbles homolog 3 (TRIB3) ELISA Kit
abx251890 96 Tests

Human Tribbles homolog 3 (TRIB3) ELISA Kit

Sign In for Pricing
View Details
4933437F05Rik Protein Vector (Mouse) (pPB-N-His)
PV149851 500 ng

4933437F05Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TCPTP (PTPN2) (NM_080423) Human Recombinant Protein
TP305090L 1 mg

TCPTP (PTPN2) (NM_080423) Human Recombinant Protein

Sign In for Pricing
View Details