Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL)

Product Specifications

Product Name Alternative

Protease IVPvdS-regulated endoprotease

Abbreviation

Recombinant Pseudomonas aeruginosa prpL protein

Gene Name

PrpL

UniProt

Q9HWK6

Expression Region

212-462aa

Organism

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Target Sequence

AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Lysine-specific endoprotease . Involved in corneal virulence.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Lysine-specific endoprotease

Molecular Weight

42.4 kDa

References & Citations

Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2CBP CRISPR Activation Plasmid (m)
sc-427673-ACT 20 µg

UBE2CBP CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
IKK epsilon (IKKe)
MBS6507740-01 0.1 mL

IKK epsilon (IKKe)

Sign In for Pricing
View Details
IKK epsilon (IKKe)
MBS6507740-02 5x 0.1 mL

IKK epsilon (IKKe)

Sign In for Pricing
View Details
SR 16832
6383/5 5 mg

SR 16832

Sign In for Pricing
View Details
Sgk223, NT (Sgk223, D8Ertd82e, Tyrosine-protein kinase SgK223, Sugen kinase 223) (Biotin) discontinued
041660-Biotin 200 µL

Sgk223, NT (Sgk223, D8Ertd82e, Tyrosine-protein kinase SgK223, Sugen kinase 223) (Biotin) discontinued

Sign In for Pricing
View Details
COPS2 Polyclonal Antibody, Biotin Conjugated
bs-9125R-Biotin 100 µL

COPS2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details