Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GMP reductase 2 (GMPR2)

Product Specifications

Product Name Alternative

Guanosine 5'-monophosphate oxidoreductase 2 ; Guanosine monophosphate reductase 2

Abbreviation

Recombinant Human GMPR2 protein

Gene Name

GMPR2

UniProt

Q9P2T1

Expression Region

1-366aa

Organism

Homo sapiens (Human)

Target Sequence

MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides

Molecular Weight

55.8 kDa

References & Citations

"Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS634135 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Slc5a2 Mouse Gene Knockout Kit (CRISPR)
KN516158 1 Kit

Slc5a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat JAM-A/F11R Protein (His Tag)
PKSR030297 50 µg

Recombinant Rat JAM-A/F11R Protein (His Tag)

Sign In for Pricing
View Details
4-Estren-17beta-ol-3-one Acetate
TRC-E887920-25MG 25 mg

4-Estren-17beta-ol-3-one Acetate

Sign In for Pricing
View Details
Adrenochrome Bisulfite Sodium Salt
TRC-A305255-10MG 10 mg

Adrenochrome Bisulfite Sodium Salt

Sign In for Pricing
View Details
Sdf2l1 Mouse Gene Knockout Kit (CRISPR)
KN515428 1 Kit

Sdf2l1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details