Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein KIAA1377 (KIAA1377), partial

Product Specifications

Product Name Alternative

CEP126; KIAA1377; Centrosomal protein of 126 kDa

Abbreviation

Recombinant Human KIAA1377 protein, partial

Gene Name

KIAA1377

UniProt

Q9P2H0

Expression Region

559-670aa

Organism

Homo sapiens (Human)

Target Sequence

HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Participates in cytokinesis

Molecular Weight

28.9 kDa

References & Citations

Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc35f1 Mouse Gene Knockout Kit (CRISPR)
KN516072 1 Kit

Slc35f1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4,4'-Thiodianiline
TRC-T350330-500MG 500 mg

4,4'-Thiodianiline

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
AP02659PU-N 100 µL

AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPL13A Polyclonal Antibody
E-AB-18938-01 20 µL

RPL13A Polyclonal Antibody

Sign In for Pricing
View Details
RPL13A Polyclonal Antibody
E-AB-18938-02 60 µL

RPL13A Polyclonal Antibody

Sign In for Pricing
View Details
RPL13A Polyclonal Antibody
E-AB-18938-03 120 µL

RPL13A Polyclonal Antibody

Sign In for Pricing
View Details