Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger matrin-type protein 5 (ZMAT5)

Product Specifications

Product Name Alternative

U11/U12 small nuclear ribonucleoprotein 20KDA protein ; U11/U12 snRNP 20KDA protein ; U11/U12-20K

Abbreviation

Recombinant Human ZMAT5 protein

Gene Name

ZMAT5

UniProt

Q9UDW3

Expression Region

1-170aa

Organism

Homo sapiens (Human)

Target Sequence

MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36 kDa

References & Citations

Cloning of human full open reading frames in Gateway (TM) system entry vector (pDONR201) .Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine receptor antagonist 6
MF-0064645-01 10 mg

Adenosine receptor antagonist 6

Sign In for Pricing
View Details
Adenosine receptor antagonist 6
MF-0064645-02 50 mg

Adenosine receptor antagonist 6

Sign In for Pricing
View Details
NRL Rabbit pAb
A16935 100 µL

NRL Rabbit pAb

Sign In for Pricing
View Details
TDRD7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46461154 3x 1.0 µg DNA

TDRD7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Npc1 shRNA (UAS) - Lentiviral mouse Npc1 shRNA (UAS) plasmid
GTR15249487 1 Vial

Lentiviral mouse Npc1 shRNA (UAS) - Lentiviral mouse Npc1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
FT113 25mg
A19402-25 25 mg

FT113 25mg

Sign In for Pricing
View Details