Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dickkopf-related protein 2 (DKK2)

Product Specifications

Product Name Alternative

Dickkopf 2; Dickkopf gene 2 ; Dickkopf homolog 2 ; Dickkopf related protein 2; Dickkopf WNT signaling pathway inhibitor 2; Dickkopf-2; Dickkopf-related protein 2; Dickkopf2; DKK 2; Dkk-2; Dkk2; DKK2_HUMAN; hDkk 2; hDkk-2; hDkk2

Abbreviation

Recombinant Human DKK2 protein

Gene Name

DKK2

UniProt

Q9UBU2

Expression Region

34-259aa

Organism

Homo sapiens (Human)

Target Sequence

KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmbrane protein KREN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity) .

Molecular Weight

41 kDa

References & Citations

Functional and structural diversity of the human Dickkopf gene family.Krupnik V.E., Sharp J.D., Jiang C., Robison K., Chickering T.W., Amaravadi L., Brown D.E., Guyot D., Mays G., Leiby K., Chang B., Duong T., Goodearl A.D.J., Gearing D.P., Sokol S.Y., McCarthy S.A.Gene 238:301-313 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-01 0.05 mg (E-Coli)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details
Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-02 0.05 mg (Yeast)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details
Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-03 0.05 mg (Baculovirus)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details
Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-04 0.2 mg (E-Coli)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details
Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-05 0.2 mg (Yeast)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details
Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)
MBS1474439-06 0.5 mg (E-Coli)

Recombinant Elaeis oleifera ATP synthase subunit beta, chloroplastic (atpB)

Ask
View Details