Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dynein light chain roadblock-type 1 (DYNLRB1), partial

Product Specifications

Product Name Alternative

Bithoraxoid-like protein ; BLPDynein light chain 2A, Cytoplasmic domainDynein-associated protein Km23Roadblock domain-containing protein 1

Abbreviation

Recombinant Human DYNLRB1 protein, partial

Gene Name

DYNLRB1

UniProt

Q9NP97

Expression Region

3-96aa

Organism

Homo sapiens (Human)

Target Sequence

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Molecular Weight

26.7 kDa

References & Citations

Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Jiang J., Yu L., Huang X., Chen X., Li D., Zhang Y., Tang L., Zhao S.Gene 281:103-113 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Buttock
CS629742 5x 5 µm

Frozen Tissue Sections, Buttock

Sign In for Pricing
View Details
SOD1 Antibody
KC-1795-01 50 μL

SOD1 Antibody

Sign In for Pricing
View Details
SOD1 Antibody
KC-1795-02 100 µL

SOD1 Antibody

Sign In for Pricing
View Details
SOD1 Antibody
KC-1795-03 1 mL

SOD1 Antibody

Sign In for Pricing
View Details
Recombinant Human IL-12 Receptor Subunit Beta1/IL-12RB1/CD212 (C-6His)
PKSH033842-01 10 µg

Recombinant Human IL-12 Receptor Subunit Beta1/IL-12RB1/CD212 (C-6His)

Sign In for Pricing
View Details
Recombinant Human IL-12 Receptor Subunit Beta1/IL-12RB1/CD212 (C-6His)
PKSH033842-02 50 µg

Recombinant Human IL-12 Receptor Subunit Beta1/IL-12RB1/CD212 (C-6His)

Sign In for Pricing
View Details