Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dynein light chain roadblock-type 1 (DYNLRB1), partial

Product Specifications

Product Name Alternative

Bithoraxoid-like protein ; BLPDynein light chain 2A, Cytoplasmic domainDynein-associated protein Km23Roadblock domain-containing protein 1

Abbreviation

Recombinant Human DYNLRB1 protein, partial

Gene Name

DYNLRB1

UniProt

Q9NP97

Expression Region

3-96aa

Organism

Homo sapiens (Human)

Target Sequence

EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Acts as one of several non-catalytic accessory components of the Cytoplasmic domain dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic domain dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Molecular Weight

26.7 kDa

References & Citations

Identification of two novel human dynein light chain genes, DNLC2A and DNLC2B, and their expression changes in hepatocellular carcinoma tissues from 68 Chinese patients.Jiang J., Yu L., Huang X., Chen X., Li D., Zhang Y., Tang L., Zhao S.Gene 281:103-113 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GRINL1A (POLR2M, DNA-directed RNA Polymerase II Subunit GRINL1A, DNA-directed RNA Polymerase II Subunit M, Glutamate Receptor-like Protein 1A DKFZp586F1918) (MaxLight 750)
MBS6233122-01 0.1 mL

GRINL1A (POLR2M, DNA-directed RNA Polymerase II Subunit GRINL1A, DNA-directed RNA Polymerase II Subunit M, Glutamate Receptor-like Protein 1A DKFZp586F1918) (MaxLight 750)

Ask
View Details
GRINL1A (POLR2M, DNA-directed RNA Polymerase II Subunit GRINL1A, DNA-directed RNA Polymerase II Subunit M, Glutamate Receptor-like Protein 1A DKFZp586F1918) (MaxLight 750)
MBS6233122-02 5x 0.1 mL

GRINL1A (POLR2M, DNA-directed RNA Polymerase II Subunit GRINL1A, DNA-directed RNA Polymerase II Subunit M, Glutamate Receptor-like Protein 1A DKFZp586F1918) (MaxLight 750)

Ask
View Details
ALPK1 Recombinant Rabbit mAb
BS45123-01 50 µL

ALPK1 Recombinant Rabbit mAb

Ask
View Details
ALPK1 Recombinant Rabbit mAb
BS45123-02 100 µL

ALPK1 Recombinant Rabbit mAb

Ask
View Details
Rat Activating Transcription Factor 3 ELISA Kit
MBS722565-01 48 Well

Rat Activating Transcription Factor 3 ELISA Kit

Ask
View Details
Rat Activating Transcription Factor 3 ELISA Kit
MBS722565-02 96 Well

Rat Activating Transcription Factor 3 ELISA Kit

Ask
View Details