Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dysbindin domain-containing protein 2 (DBNDD2)

Product Specifications

Product Name Alternative

Casein kinase-1 binding protein ; CK1BPHSMNP1

Abbreviation

Recombinant Human DBNDD2 protein

Gene Name

DBNDD2

UniProt

Q9BQY9

Expression Region

1-161aa

Organism

Homo sapiens (Human)

Target Sequence

MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro) .

Molecular Weight

33.5 kDa

References & Citations

Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. , Zhou J., Xu S.-H., Gu J., Shi J.-X., Jin W.-R., Zhang C.-K., Wu T.-M., Huang G.-Y., Chen Z., Chen M.-D., Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lung Parenchymal Fibroblast Culture Medium - 3
ARM1061 500 mL

Human Lung Parenchymal Fibroblast Culture Medium - 3

Sign In for Pricing
View Details
Rat Mcpt4 protein
orb604539-01 20 µg

Rat Mcpt4 protein

Sign In for Pricing
View Details
Rat Mcpt4 protein
orb604539-02 100 µg

Rat Mcpt4 protein

Sign In for Pricing
View Details
Rat Mcpt4 protein
orb604539-03 1 mg

Rat Mcpt4 protein

Sign In for Pricing
View Details
5-HT6/7 antagonist 1
HY-101622 1 mg

5-HT6/7 antagonist 1

Sign In for Pricing
View Details
Recombinant Mouse Ventral anterior homeobox 2 (Vax2)
MBS1313417-01 0.02 mg (E-Coli)

Recombinant Mouse Ventral anterior homeobox 2 (Vax2)

Sign In for Pricing
View Details