Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gem-associated protein 7 (GEMIN7)

Product Specifications

Product Name Alternative

SIP3

Abbreviation

Recombinant Human GEMIN7 protein

Gene Name

GEMIN7

UniProt

Q9H840

Expression Region

1-131aa

Organism

Homo sapiens (Human)

Target Sequence

MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

The SMN complex plays a catalyst role in the assbly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assbly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assbly of core snRNPs and their transport to the nucleus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus.

Molecular Weight

41.5 kDa

References & Citations

Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.Baccon J., Pellizzoni L., Rappsilber J., Mann M., Dreyfuss G.J. Biol. Chem. 277:31957-31962 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)
MBS7034864-01 0.02 mg

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

Ask
View Details
Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)
MBS7034864-02 0.1 mg

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

Ask
View Details
Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)
MBS7034864-03 5x 0.1 mg

Recombinant Staphylococcus aureus Membrane protein insertase YidC (yidC)

Ask
View Details
Carbon catabolite-derepressing protein kinase (SNF1) Antibody
abx345773-01 20 µL

Carbon catabolite-derepressing protein kinase (SNF1) Antibody

Ask
View Details
Carbon catabolite-derepressing protein kinase (SNF1) Antibody
abx345773-02 50 µL

Carbon catabolite-derepressing protein kinase (SNF1) Antibody

Ask
View Details
Carbon catabolite-derepressing protein kinase (SNF1) Antibody
abx345773-03 100 µL

Carbon catabolite-derepressing protein kinase (SNF1) Antibody

Ask
View Details