Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Programmed cell death protein 10 (PDCD10)

Product Specifications

Product Name Alternative

Cerebral cavernous malformations 3 protein; TF-1 cell apoptosis-related protein 15

Abbreviation

Recombinant Human PDCD10 protein

Gene Name

PDCD10

UniProt

Q9BUL8

Expression Region

1-212aa

Organism

Homo sapiens (Human)

Target Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assbly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hatopoiesis during bryonic development .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity

Molecular Weight

40.7 kDa

References & Citations

CDNA cloning and expression of an apoptosis-related gene, human TFAR-15 gene.Wang Y.G., Liu H.T., Ma D.L., Zhang Y.M.Sci. China, Ser. C, Life Sci. 42:323-329 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC5, CT (ARMC5, Armadillo repeat-containing protein 5) (Biotin) discontinued
032086-Biotin 200 µL

ARMC5, CT (ARMC5, Armadillo repeat-containing protein 5) (Biotin) discontinued

Sign In for Pricing
View Details
Goat anti-ADAM12 Antibody
orb18958 100 µg

Goat anti-ADAM12 Antibody

Sign In for Pricing
View Details
PIP4K2B (PIP5K2B) discontinued
512810 100 µg

PIP4K2B (PIP5K2B) discontinued

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase chain 4, chloroplastic, partial
MBS1066776-01 1 mg (E-Coli)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase chain 4, chloroplastic, partial

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase chain 4, chloroplastic, partial
MBS1066776-02 1 mg (Yeast)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase chain 4, chloroplastic, partial

Sign In for Pricing
View Details
4-Chlorophenothiazine
sc-501113 250 mg

4-Chlorophenothiazine

Sign In for Pricing
View Details