Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Staphopain B (sspB)

Product Specifications

Product Name Alternative

Staphylococcal cysteine proteinase BStaphylopain B

Abbreviation

Recombinant Staphylococcus aureus sspB protein

Gene Name

SspB

UniProt

Q99V46

Expression Region

220-393aa

Organism

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Target Sequence

DQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCSTFPNQMIEYGKSQGRDIHYQEGVPSYEQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVGNAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other Extracellular domain proteases is involved in colonization and infection of human tissues .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cysteine protease able to degrade elastin, fibrogen, fibronectin and kininogen. Exhibits a strong preference for substrates where arginine is preceded by a hydrophobic amino acid. Promotes detachment of primary human keratinocytes. Along with other extracellular proteases is involved in colonization and infection of human tissues (By similarity) .

Molecular Weight

46.9 kDa

References & Citations

Genetic characterization of staphopain genes in Staphylococcus aureus.Golonka E., Filipek R., Sabat A., Sinczak A., Potempa J.Biol. Chem. 385:1059-1067 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPINK1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-2916R-APC-Cy5.5 100 µL

SPINK1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
NTRK2 Immunizing Peptide
orb737978 100 µg

NTRK2 Immunizing Peptide

Sign In for Pricing
View Details
Lias sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4054407 1.0 µg DNA

Lias sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Thymidylate kinase (tmk)
MBS1356780-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Thymidylate kinase (tmk)
MBS1356780-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Thymidylate kinase (tmk)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Thymidylate kinase (tmk)
MBS1356780-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Thymidylate kinase (tmk)

Sign In for Pricing
View Details