What is the catalog number for Recombinant Human Histone H2B type 1-N (HIST1H2BN)?

The catalog number for Recombinant Human Histone H2B type 1-N (HIST1H2BN) is CSB-EP857877HU.

What sizes are available for Recombinant Human Histone H2B type 1-N (HIST1H2BN)?

Recombinant Human Histone H2B type 1-N (HIST1H2BN) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Histone H2B type 1-N (HIST1H2BN) come in?

Recombinant Human Histone H2B type 1-N (HIST1H2BN) is available in 3 different pack sizes.

Is Recombinant Human Histone H2B type 1-N (HIST1H2BN) in stock?

Recombinant Human Histone H2B type 1-N (HIST1H2BN) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Histone H2B type 1-N (HIST1H2BN)?

Recombinant Human Histone H2B type 1-N (HIST1H2BN) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Histone H2B type 1-N (HIST1H2BN)?

Estimated delivery time for Recombinant Human Histone H2B type 1-N (HIST1H2BN) is approximately 15 business day(s), depending on your location.

Recombinant Human Histone H2B type 1-N (HIST1H2BN)

Product Specifications

Product Name Alternative

Histone H2B.d ; H2B/d

Abbreviation

Recombinant Human HIST1H2BN protein

Gene Name

HIST1H2BN

UniProt

Q99877

Expression Region

2-126aa

Organism

Homo sapiens (Human)

Target Sequence

PEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molecular Weight

29.8 kDa

References & Citations

The human and mouse replication-dependent histone genes.Marzluff W.F., Gongidi P., Woods K.R., Jin J., Maltais L.J.Genomics 80:487-498 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.