Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metalloproteinase inhibitor 4 (TIMP4)

Product Specifications

Product Name Alternative

Tissue inhibitor of metalloproteinases 4 ; TIMP-4

Abbreviation

Recombinant Human TIMP-4 protein

Gene Name

TIMP-4

UniProt

Q99727

Expression Region

30-224aa

Organism

Homo sapiens (Human)

Target Sequence

CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.

Molecular Weight

24.4 kDa

References & Citations

Molecular cloning and characterization of human tissue inhibitor of metalloproteinase 4.Greene J., Wang M., Liu Y.E., Raymond L.A., Rosen C., Shi Y.E.J. Biol. Chem. 271:30375-30380 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit
MBS9352079-01 48 Well

Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit
MBS9352079-02 96 Well

Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit
MBS9352079-03 5x 96 Well

Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit
MBS9352079-04 10x 96 Well

Monkey Glutaminyl-tRNA Synthetase (QARS) ELISA Kit

Sign In for Pricing
View Details
MAPK4 (NM_002747) Human Tagged Lenti ORF Clone
RC207414L4 10 µg

MAPK4 (NM_002747) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD63 (MaxLight 750)
MBS6256796-01 0.1 mL

CD63 (MaxLight 750)

Sign In for Pricing
View Details