Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chamaecyparis obtusa Pectate lyase 1

Product Specifications

Product Name Alternative

Pectate lyase 1; EC 4.2.2.2; Major pollen allergen Cha o 1; allergen Cha o 1

Abbreviation

Recombinant Chamaecyparis obtusa Pectate lyase 1 protein

UniProt

Q96385

Expression Region

22-375aa

Organism

Chamaecyparis obtusa (Hinoki false-cypress)

Target Sequence

DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Has pectate lyase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has pectate lyase activity.

Molecular Weight

54.1 kDa

References & Citations

Purification, characterization and molecular cloning of Cha o 1, a major allergen of Chamaecyparis obtusa (Japanese cypress) pollen.Suzuki M., Komiyama N., Itoh M., Itoh H., Sone T., Kuno K., Takagi I., Ohta N.Mol. Immunol. 33:451-460 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-500 1x 500 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF647 conjugate, 0.1mg/mL
BNC470715-500 1x 500 µL

Thymidylate Synthase (TMS715), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF740 conjugate, 0.1mg/mL
BNC741025-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details