Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial

Product Specifications

Product Name Alternative

2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein ; LP4791 protein ; W117m

Abbreviation

Recombinant Human ESAM protein, partial

Gene Name

ESAM

UniProt

Q96AP7

Expression Region

30-248aa

Organism

Homo sapiens (Human)

Target Sequence

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Adhesion

Relevance

Can mediate aggregation most likely through a homophilic molecular interaction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Can mediate aggregation most likely through a homophilic molecular interaction.

Molecular Weight

39.8 kDa

References & Citations

Cloning of an immunoglobulin family adhesion molecule selectively expressed by endothelial cells.Hirata K., Ishida T., Penta K., Rezaee M., Yang E., Wohlgemuth J., Quertermous T.J. Biol. Chem. 276:16223-16231 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mps1-IN-1
MBS5753519 Inquire

Mps1-IN-1

Sign In for Pricing
View Details
Monkey RELT-like protein 1 (RELL1) ELISA Kit
MBS7207310-01 48 Well

Monkey RELT-like protein 1 (RELL1) ELISA Kit

Sign In for Pricing
View Details
Monkey RELT-like protein 1 (RELL1) ELISA Kit
MBS7207310-02 96 Well

Monkey RELT-like protein 1 (RELL1) ELISA Kit

Sign In for Pricing
View Details
Monkey RELT-like protein 1 (RELL1) ELISA Kit
MBS7207310-03 5x 96 Well

Monkey RELT-like protein 1 (RELL1) ELISA Kit

Sign In for Pricing
View Details
Monkey RELT-like protein 1 (RELL1) ELISA Kit
MBS7207310-04 10x 96 Well

Monkey RELT-like protein 1 (RELL1) ELISA Kit

Sign In for Pricing
View Details
Human Dipeptidase 3 (DPEP3) ELISA Kit
MBS2019515-01 24 Strip Well

Human Dipeptidase 3 (DPEP3) ELISA Kit

Sign In for Pricing
View Details