Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Butyrophilin subfamily 2 member A2 (BTN2A2), partial

Product Specifications

Product Name Alternative

BT2.2; BT2A2_HUMAN; BTF2; BTN2A2; butyrophilin 2 ; Butyrophilin subfamily 2 member A2

Abbreviation

Recombinant Human BTN2A2 protein, partial

Gene Name

BTN2A2

UniProt

Q8WVV5

Expression Region

33-262aa

Organism

Homo sapiens (Human)

Target Sequence

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.

Molecular Weight

41.7 kDa

References & Citations

A 1.1-Mb transcript map of the hereditary hemochromatosis locus.Ruddy D.A., Kronmal G.S., Lee V.K., Mintier G.A., Quintana L., Domingo R. Jr., Meyer N.C., Irrinki A., McClelland E.E., Fullan A., Mapa F.A., Moore T., Thomas W., Loeb D.B., Harmon C., Tsuchihashi Z., Wolff R.K., Schatzman R.C., Feder J.N.Genome Res. 7:441-456 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-500 1x 500 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL
BNC682078-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL
BNC040416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL
BNC742038-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details