Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-3C (RAB3C)

Product Specifications

Product Name Alternative

RAB3C; RAB3C member RAS oncogene family; RAB3C_HUMAN; Ras related protein Rab3C; Ras-related protein Rab-3C

Abbreviation

Recombinant Human RAB3C protein

Gene Name

RAB3C

UniProt

Q96E17

Expression Region

1-227aa

Organism

Homo sapiens (Human)

Target Sequence

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transport

Relevance

Protein transport. Probably involved in vesicular traffic .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protein transport. Probably involved in vesicular traffic (By similarity) .

Molecular Weight

42 kDa

References & Citations

Cloning, mapping, and characterization of the human Rab3C gene.Cheng H., Ma Y., Ni X., Jiang M., Luo Y., Ying K., Xie Y., Ma Y.Biochem. Genet. 40:263-272 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem198b Rat shRNA Lentiviral Particle (Locus ID 500762)
TL707783V 500 µL Each

Tmem198b Rat shRNA Lentiviral Particle (Locus ID 500762)

Sign In for Pricing
View Details
TIG2 Lentiviral Activation Particles (m)
sc-427992-LAC 200 µL

TIG2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
DMTr-2'-F-dG (dmf) -3'- (L) -PSM-Phosphoramidite
PA080-10 10 g

DMTr-2'-F-dG (dmf) -3'- (L) -PSM-Phosphoramidite

Sign In for Pricing
View Details
Acid Phosphatase 2 (ACP2) (NM_001131064) Human Over-expression Lysate
LC427374 20 µg

Acid Phosphatase 2 (ACP2) (NM_001131064) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Canine CTLA4 Protein, His-tagged, FITC conjugated
CTLA4-1061CF 20 μg- 50 μg- 100 μg

Recombinant Canine CTLA4 Protein, His-tagged, FITC conjugated

Sign In for Pricing
View Details
RPL39L Human Gene Knockout Kit (CRISPR)
KN404191 1 Kit

RPL39L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details