Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protease serine 4 (Tmprss4), partial

Product Specifications

Product Name Alternative

Channel-activating protease 2 ; mCAP2

Abbreviation

Recombinant Mouse Tmprss4 protein, partial

Gene Name

Tmprss4

UniProt

Q8VCA5

Expression Region

52-435aa

Organism

Mus musculus (Mouse)

Target Sequence

KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Probable protease. Ses to be capable of activating ENaC.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable protease. Seems to be capable of activating ENaC.

Molecular Weight

57.8 kDa

References & Citations

Synergistic activation of ENaC by three membrane-bound channel-activating serine proteases (mCAP1, mCAP2, and mCAP3) and serum- and glucocorticoid-regulated kinase (Sgk1) in Xenopus oocytes.Vuagniaux G., Vallet V., Jaeger N.F., Hummler E., Rossier B.C.J. Gen. Physiol. 120:191-201 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HnRNP K Recombinant Antibody, PE-Cy7 Conjugated
bsm-61246R-PE-Cy7-TR 20 µL

HnRNP K Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Reagecon Ammonium Cerium Nitrate 0.1M according to European Pharmacopoeia (EP) Chapter 4 (4.2.2)
3000100 1 L

Reagecon Ammonium Cerium Nitrate 0.1M according to European Pharmacopoeia (EP) Chapter 4 (4.2.2)

Sign In for Pricing
View Details
.. - 125ML
CLMS-2A-01 1 Each

.. - 125ML

Sign In for Pricing
View Details
.. - 125ML
CLMS-2A-02 125 mL

.. - 125ML

Sign In for Pricing
View Details
.. - 125ML
CLMS-2A-03 125 mL

.. - 125ML

Sign In for Pricing
View Details
.. - 125ML
CLMS-2A-04 125 mL

.. - 125ML

Sign In for Pricing
View Details