Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 124 (DEFB124)

Product Specifications

Product Name Alternative

Beta-defensin 24 ; DEFB-24Defensin, beta 124

Abbreviation

Recombinant Human DEFB124 protein

Gene Name

DEFB124

UniProt

Q8NES8

Expression Region

23-71aa

Organism

Homo sapiens (Human)

Target Sequence

EFKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Has antibacterial activity.Curated

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has antibacterial activity.

Molecular Weight

21.7 kDa

References & Citations

Discovery of five conserved beta-defensin gene clusters using a computational search strategy.Schutte B.C., Mitros J.P., Bartlett J.A., Walters J.D., Jia H.P., Welsh M.J., Casavant T.L., McCray P.B. Jr.Proc. Natl. Acad. Sci. U.S.A. 99:2129-2133 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Rabbit Polyclonal Antibody to Rat IgG
FA-2362-2 2 mL

FITC Conjugated Rabbit Polyclonal Antibody to Rat IgG

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF405S conjugate, 0.1mg/mL
BNC042925-100 1x 100 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABCB10 Antibody
8C14619-AAT 50 µg

ABCB10 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS631711 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details
Nrf3 Rabbit polyclonal Antibody
HA500570 100 µL

Nrf3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Disperse Yellow 9 D4
TRC-D495369-25MG 25 mg

Disperse Yellow 9 D4

Sign In for Pricing
View Details