Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase (ST8SIA4)
Product Specifications
Product Name Alternative
Alpha-2,8-sialyltransferase 8DPolysialyltransferase-1Sialyltransferase 8D ; SIAT8-DSialyltransferase St8Sia IV ; ST8SiaIV
Abbreviation
Recombinant Human ST8SIA4 protein
Gene Name
ST8SIA4
UniProt
Q92187
Expression Region
21-168aa
Organism
Homo sapiens (Human)
Target Sequence
KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Tag
N-terminal 6xHis-SUMO-tagged
Type
Developed Protein
Source
E.coli
Field of Research
Tags & Cell Markers
Relevance
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Molecular Weight
32.8 kDa
References & Citations
Expression cloning of a human polysialyltransferase that forms the polysialylated neural cell adhesion molecule present in embryonic brain.Nakayama J., Fukuda M.N., Fredette B., Ranscht B., Fukuda M.Proc. Natl. Acad. Sci. U.S.A. 92:7031-7035 (1995)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Isoform 2
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741077-100 1x 100 µL
Cytokeratin, LMW (KRTL/1077), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400753-500 1x 500 µL
Cytokeratin 19 (A53-B/A2.26 + BA17), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details