Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial

Product Specifications

Product Name Alternative

Tumor necrosis factor C ; TNF-CTumor necrosis factor ligand superfamily member 3

Abbreviation

Recombinant Chimpanzee LTB protein, partial

Gene Name

LTB

UniProt

Q862Z7

Expression Region

49-244aa

Organism

Pan troglodytes (Chimpanzee)

Target Sequence

QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the mbrane anchor for the attachment of the heterotrimeric complex to the cell surface .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface (By similarity) .

Molecular Weight

24.8 kDa

References & Citations

Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M., Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K., Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A. , Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T., Inoko H., Bahram S.Genetics 173:1555-1570 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM7 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04321 0.1 mg

CEACAM7 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Apigenin Triacetate
441663-01 1 mg

Apigenin Triacetate

Sign In for Pricing
View Details
Apigenin Triacetate
441663-02 2.5 mg

Apigenin Triacetate

Sign In for Pricing
View Details
Prp2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
37753126 3x 1.0µg DNA

Prp2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
BMPR1B, NT (D17) (Bone Morphogenetic Protein Receptor Type-1B, BMP Type-1B Receptor, BMPR-1B, CDw293) (MaxLight 650) discontinued
B2553-63C-ML650 100 µL

BMPR1B, NT (D17) (Bone Morphogenetic Protein Receptor Type-1B, BMP Type-1B Receptor, BMPR-1B, CDw293) (MaxLight 650) discontinued

Sign In for Pricing
View Details
β-Catenin (Ab-33) Conjugated Antibody
orb1629324 100 µL

β-Catenin (Ab-33) Conjugated Antibody

Sign In for Pricing
View Details