Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb)

Product Specifications

Product Name Alternative

Ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSB

Abbreviation

Recombinant Bacillus anthracis ssb protein

Gene Name

Ssb

UniProt

Q81JI3

Expression Region

1-172aa

Organism

Bacillus anthracis

Target Sequence

MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit th to their sites of action during DNA metabolism.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism.

Molecular Weight

34.7 kDa

References & Citations

The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria.Read T.D., Peterson S.N., Tourasse N.J., Baillie L.W., Paulsen I.T., Nelson K.E., Tettelin H., Fouts D.E., Eisen J.A., Gill S.R., Holtzapple E.K., Okstad O.A., Helgason E., Rilstone J., Wu M., Kolonay J.F., Beanan M.J., Dodson R.J. , Brinkac L.M., Gwinn M.L., DeBoy R.T., Madpu R., Daugherty S.C., Durkin A.S., Haft D.H., Nelson W.C., Peterson J.D., Pop M., Khouri H.M., Radune D., Benton J.L., Mahamoud Y., Jiang L., Hance I.R., Weidman J.F., Berry K.J., Plaut R.D., Wolf A.M., Watkins K.L., Nierman W.C., Hazen A., Cline R.T., Redmond C., Thwaite J.E., White O., Salzberg S.L., Thomason B., Friedlander A.M., Koehler T.M., Hanna P.C., Kolstoe A.-B., Fraser C.M.Nature 423:81-86 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXI1 Human qPCR Template Standard (NM_144769)
HK211757 1 Kit

FOXI1 Human qPCR Template Standard (NM_144769)

Sign In for Pricing
View Details
Rabbit Polyclonal ER alpha/NR3A1 [p Ser106] Antibody
NB100-81912-0.025mL 0.025 mL

Rabbit Polyclonal ER alpha/NR3A1 [p Ser106] Antibody

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV A33R Protein, N-His
orb2966563-01 50 µg

Recombinant Monkeypox virus/MPXV A33R Protein, N-His

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV A33R Protein, N-His
orb2966563-02 100 µg

Recombinant Monkeypox virus/MPXV A33R Protein, N-His

Sign In for Pricing
View Details
Recombinant Monkeypox virus/MPXV A33R Protein, N-His
orb2966563-03 1 mg

Recombinant Monkeypox virus/MPXV A33R Protein, N-His

Sign In for Pricing
View Details
Tianeptine sodium
MBS386219-01 1 mL (in DMSO)

Tianeptine sodium

Sign In for Pricing
View Details