Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb)

Product Specifications

Product Name Alternative

Ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSB

Abbreviation

Recombinant Bacillus anthracis ssb protein

Gene Name

Ssb

UniProt

Q81JI3

Expression Region

1-172aa

Organism

Bacillus anthracis

Target Sequence

MNRVILVGRLTKDPDLRYTPNGVAVATFTLAVNRAFANQQGEREADFINCVIWRKQAENVANYLKKGSLAGVDGRLQTRNYEGQDGKRVYVTEVLAESVQFLEPRNGGGEQRGSFNQQPSGAGFGNQSSNPFGQSSNSGNQGNQGNSGFTKNDDPFSNVGQPIDISDDDLPF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit th to their sites of action during DNA metabolism.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism.

Molecular Weight

34.7 kDa

References & Citations

The genome sequence of Bacillus anthracis Ames and comparison to closely related bacteria.Read T.D., Peterson S.N., Tourasse N.J., Baillie L.W., Paulsen I.T., Nelson K.E., Tettelin H., Fouts D.E., Eisen J.A., Gill S.R., Holtzapple E.K., Okstad O.A., Helgason E., Rilstone J., Wu M., Kolonay J.F., Beanan M.J., Dodson R.J. , Brinkac L.M., Gwinn M.L., DeBoy R.T., Madpu R., Daugherty S.C., Durkin A.S., Haft D.H., Nelson W.C., Peterson J.D., Pop M., Khouri H.M., Radune D., Benton J.L., Mahamoud Y., Jiang L., Hance I.R., Weidman J.F., Berry K.J., Plaut R.D., Wolf A.M., Watkins K.L., Nierman W.C., Hazen A., Cline R.T., Redmond C., Thwaite J.E., White O., Salzberg S.L., Thomason B., Friedlander A.M., Koehler T.M., Hanna P.C., Kolstoe A.-B., Fraser C.M.Nature 423:81-86 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R3C Rabbit Polyclonal Antibody (Biotin)
orb3128523 100 µg

PPP1R3C Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Di (zanamivir-amide (N-Me) -PEG1) -N-PEG4-alkyne
HY-176962 1 Each

Di (zanamivir-amide (N-Me) -PEG1) -N-PEG4-alkyne

Sign In for Pricing
View Details
Anti-Treponema pallidum tmpA Polyclonal Antibody
JN858014-01 50 µg

Anti-Treponema pallidum tmpA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Treponema pallidum tmpA Polyclonal Antibody
JN858014-02 100 µg

Anti-Treponema pallidum tmpA Polyclonal Antibody

Sign In for Pricing
View Details
Rat Duox2 Pre-designed siRNA Set B
SI204092B 1 Each

Rat Duox2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
7-Bromo-DL-tryptophan
OR930993-01 100 mg

7-Bromo-DL-tryptophan

Sign In for Pricing
View Details