Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6)

Product Specifications

Product Name Alternative

LYPD6; UNQ3023/PRO9821Ly6/PLAUR domain-containing protein 6

Abbreviation

Recombinant Human LYPD6 protein

Gene Name

LYPD6

UniProt

Q86Y78

Expression Region

23-171aa

Organism

Homo sapiens (Human)

Target Sequence

AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca (2+) influx through nAChRs

Molecular Weight

43.8 kDa

References & Citations

The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD4L6 (NM_001085476) Human Over-expression Lysate
LY421321 100 µg

FOXD4L6 (NM_001085476) Human Over-expression Lysate

Sign In for Pricing
View Details
Abcg8 Mouse Gene Knockout Kit (CRISPR)
KN500644 1 Kit

Abcg8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Pentylbromobenzene
TRC-P279790-5G 5 g

4-Pentylbromobenzene

Sign In for Pricing
View Details
Human YIPF1 activation kit by CRISPRa
GA110095 1 Kit

Human YIPF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Oleoyl-L-carnitine
TRC-O526700-25MG 25 mg

Oleoyl-L-carnitine

Sign In for Pricing
View Details
Nicotinuric Acid-d4
TRC-N433502-2.5MG 2.5 mg

Nicotinuric Acid-d4

Sign In for Pricing
View Details