Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

Product Specifications

Product Name Alternative

ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5

Abbreviation

Recombinant Human ITIH5 protein, partial

Gene Name

ITIH5

UniProt

Q86UX2

Expression Region

35-161aa

Organism

Homo sapiens (Human)

Target Sequence

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May act as a tumor suppressor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May act as a tumor suppressor.

Molecular Weight

30.6 kDa

References & Citations

ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST Antibody (Biotin)
abx448869 100 µg

GST Antibody (Biotin)

Sign In for Pricing
View Details
Raptor Rabbit Monoclonal Antibody
E28G1468 100 µL

Raptor Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cacng7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7062006 1.0 µg DNA

Cacng7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Hop Latent Viroid One-Step PCR kit
Oneq-A544-50R-01 50 Reactions

Hop Latent Viroid One-Step PCR kit

Sign In for Pricing
View Details
Hop Latent Viroid One-Step PCR kit
Oneq-A544-50R-02 50 Reactions

Hop Latent Viroid One-Step PCR kit

Sign In for Pricing
View Details
pCMV-TagBFP-PLEKHM1-3×FLAG-Neo Plasmid
PVT46769 2 µg

pCMV-TagBFP-PLEKHM1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details