Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

Product Specifications

Product Name Alternative

ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5

Abbreviation

Recombinant Human ITIH5 protein, partial

Gene Name

ITIH5

UniProt

Q86UX2

Expression Region

35-161aa

Organism

Homo sapiens (Human)

Target Sequence

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May act as a tumor suppressor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May act as a tumor suppressor.

Molecular Weight

30.6 kDa

References & Citations

ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNMT (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2)
247170 200 µL

HNMT (Histamine N-Methyltransferase, HMT, HNMT-S1, HNMT-S2)

Sign In for Pricing
View Details
T-Cell Surface Glycoprotein CD5 (CD5) Antibody
abx415024 0.25 mg

T-Cell Surface Glycoprotein CD5 (CD5) Antibody

Sign In for Pricing
View Details
D4Bwg0951e Protein Vector (Mouse) (pPM-C-HA)
PV170184 500 ng

D4Bwg0951e Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PGAM4P2 Protein Vector (Human) (pPM-C-His)
PV110633 500 ng

PGAM4P2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3) (MaxLight 750) discontinued
126810-ML750 100 µL

FHL2 (Four and a Half LIM Domains Protein 2, FHL-2 Protein, Aging Associated Gene 11, AAG11, DRAL, LIM Domain Protein DRAL, Skeletal Muscle LIM Protein 3, SLIM3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TAF2, CT (TAF2, CIF150, TAF2B, Transcription initiation factor TFIID subunit 2, 150kD cofactor of initiator function, RNA polymerase II TBP-associated factor subunit B, TBP-associated factor 150kD, Transcription initiation factor TFIID 150kD subunit) (PE)
MBS6353379-01 0.2 mL

TAF2, CT (TAF2, CIF150, TAF2B, Transcription initiation factor TFIID subunit 2, 150kD cofactor of initiator function, RNA polymerase II TBP-associated factor subunit B, TBP-associated factor 150kD, Transcription initiation factor TFIID 150kD subunit) (PE)

Sign In for Pricing
View Details