Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial

Product Specifications

Product Name Alternative

ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5

Abbreviation

Recombinant Human ITIH5 protein, partial

Gene Name

ITIH5

UniProt

Q86UX2

Expression Region

35-161aa

Organism

Homo sapiens (Human)

Target Sequence

VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

May act as a tumor suppressor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May act as a tumor suppressor.

Molecular Weight

30.6 kDa

References & Citations

ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-36 alpha/IL-1F6
2297-mL-025 25 µg

Recombinant Mouse IL-36 alpha/IL-1F6

Sign In for Pricing
View Details
Cyp27a1 sgRNA CRISPR Lentivector set (Rat)
K7201901 3x 1.0 µg

Cyp27a1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FFPE and Frozen Matched Pair Genomic DNA: Human Tumor Tissue: Stomach
D8235248-FP 2x 2 µg

FFPE and Frozen Matched Pair Genomic DNA: Human Tumor Tissue: Stomach

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Mouse TIM-3 / HAVCR2 (20-191) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag
MP0450F Each

Magic™ Antibody Discovery - Mouse TIM-3 / HAVCR2 (20-191) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis Mb2256c Protein (aa 1-364)
VAng-Yyj3425-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Bovis Mb2256c Protein (aa 1-364)

Sign In for Pricing
View Details
Abhydrolase Domain Containing 2 (ABHD2) Antibody (Biotin)
abx302959-01 20 µg

Abhydrolase Domain Containing 2 (ABHD2) Antibody (Biotin)

Sign In for Pricing
View Details