Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 14 (Defb14)

Product Specifications

Product Name Alternative

Defensin, beta 14

Abbreviation

Recombinant Mouse Defb14 protein

Gene Name

Defb14

UniProt

Q7TNV9

Expression Region

23-67aa

Organism

Mus musculus (Mouse)

Target Sequence

FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Has antibacterial activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has antibacterial activity.

Molecular Weight

21.2 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ."The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGIS (NM_000961) Human Tagged ORF Clone Lentiviral Particle
RC211030L3V 200 µL

PTGIS (NM_000961) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GTF2IRD1 Protein Vector (Mouse) (pPM-C-His)
PV187213 500 ng

GTF2IRD1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Apis mellifera Trehalase
orb2902156-01 20 µg

Recombinant Apis mellifera Trehalase

Sign In for Pricing
View Details
Recombinant Apis mellifera Trehalase
orb2902156-02 100 µg

Recombinant Apis mellifera Trehalase

Sign In for Pricing
View Details
TIP21 (TTFIP, TTF-I Interacting Peptide 21, Transcription Termination Factor I Interacting Peptide 21) Control Peptide discontinued
T5499-65P 1 mg

TIP21 (TTFIP, TTF-I Interacting Peptide 21, Transcription Termination Factor I Interacting Peptide 21) Control Peptide discontinued

Sign In for Pricing
View Details
HSPA2 Antibody
OC-1925-01 50 μL

HSPA2 Antibody

Sign In for Pricing
View Details