Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Arachin Ahy-3, partial

Product Specifications

Product Name Alternative

Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha; Arachin Ahy-3 chain beta]

Abbreviation

Recombinant Arachis hypogaea Arachin Ahy-3 protein, partial

UniProt

Q647H2

Expression Region

299-478aa

Organism

Arachis hypogaea (Peanut)

Target Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.9 kDa

References & Citations

Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gm14288 activation kit by CRISPRa
GA201306 1 Kit

Mouse Gm14288 activation kit by CRISPRa

Sign In for Pricing
View Details
Sh3bp4 Mouse Gene Knockout Kit (CRISPR)
KN515714 1 Kit

Sh3bp4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B-D-Threo-thymidylyl-(3'→5')-B-D-threo-thymidine-13C2 Ammonia Salt
TRC-H423412-5MG 5 mg

B-D-Threo-thymidylyl-(3'→5')-B-D-threo-thymidine-13C2 Ammonia Salt

Sign In for Pricing
View Details
PS2 (GE2), CF405S conjugate, 0.1mg/mL
BNC040677-500 1x 500 µL

PS2 (GE2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSC Human qPCR Primer Pair (NM_173849)
HP218524 200 Reactions

GSC Human qPCR Primer Pair (NM_173849)

Sign In for Pricing
View Details
PISD Mouse Monoclonal Antibody [Clone ID: OTI3B11]
CF807329 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI3B11]

Sign In for Pricing
View Details