Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BEN domain-containing protein 3 (BEND3), partial

Product Specifications

Product Name Alternative

BEN domain containing 3; BEN domain-containing protein 3; Bend3; BEND3_HUMAN; KIAA1553; RP11-59I9.2

Abbreviation

Recombinant Human BEND3 protein, partial

Gene Name

BEND3

UniProt

Q5T5X7

Expression Region

328-461aa

Organism

Homo sapiens (Human)

Target Sequence

CLPQLNDFFSRFWAQREMEDSQPSGQVASFFEAEQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFPELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPD

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional repressor which associates with the NoRC (nucleolar remodeling complex) complex and plays a key role in repressing rDNA transcription. The sumoylated form modulates the stability of the NoRC complex component BAZ2A/TIP5 by controlling its USP21-mediated deubiquitination

Molecular Weight

42.5 kDa

References & Citations

System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)
MBS2041470-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Beta-Thromboglobulin (bTG)

Sign In for Pricing
View Details