Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nucleoredoxin-like protein 2 (NXNL2)

Product Specifications

Product Name Alternative

Rod-derived cone viability factor 2 ; RdCVF2

Abbreviation

Recombinant Human NXNL2 protein

Gene Name

NXNL2

UniProt

Q5VZ03

Expression Region

1-135aa

Organism

Homo sapiens (Human)

Target Sequence

MVDILGERHLVTCKGATVEAEAALQNKVVALYFAAARCAPSRDFTPLLCDFYTALVAEARRPAPFEVVFVSADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHCNLCLLGSSDSLALAS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the maintenance of both the function and the viability of sensory neurons, including photoreceptors and olfactory neurons.

Molecular Weight

30.7 kDa

References & Citations

DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF405S conjugate, 0.1mg/mL
BNC043529-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3529), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BPV-1 Protein E2 (182-190) Mouse Monoclonal Antibody [Clone ID: 1E2]
AM26101PU-N 100 µg

BPV-1 Protein E2 (182-190) Mouse Monoclonal Antibody [Clone ID: 1E2]

Sign In for Pricing
View Details
Cytochrome C Oxidase subunit VIb (COX6B1) (C-term) Rabbit Polyclonal Antibody
AP51035PU-N 400 µL

Cytochrome C Oxidase subunit VIb (COX6B1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate
LC432314 20 µg

ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate

Sign In for Pricing
View Details
alpha Actin (cardiac actin) Rabbit Polyclonal Antibody
0407-3 100 µL

alpha Actin (cardiac actin) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPG Glycol-d6
TRC-N897006-500MG 500 mg

NPG Glycol-d6

Sign In for Pricing
View Details