Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tubulin-specific chaperone cofactor E-like protein (TBCEL)

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 35

Abbreviation

Recombinant Human TBCEL protein

Gene Name

TBCEL

UniProt

Q5QJ74

Expression Region

1-424aa

Organism

Homo sapiens (Human)

Target Sequence

MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Acts as a regulator of tubulin stability.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a regulator of tubulin stability.

Molecular Weight

64.2 kDa

References & Citations

Identification of a novel tubulin-destabilizing protein related to the chaperone cofactor E.Bartolini F., Tian G., Piehl M., Cassimeris L., Lewis S.A., Cowan N.J.J. Cell Sci. 118:1197-1207 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-02 0.02 mg (Yeast)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-03 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-04 0.1 mg (Yeast)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-05 0.02 mg (Baculovirus)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)
MBS1227136-06 0.02 mg (Mammalian-Cell)

Recombinant Haemophilus influenzae Spermidine/putrescine-binding periplasmic protein 1 (potD-B)

Sign In for Pricing
View Details