Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf73 (C11orf73)

Product Specifications

Product Name Alternative

C11orf73; Chromosome 11 open reading frame 73; CK073_HUMAN; FLJ43020; Hikeshi; HSPC138; HSPC179; L7RN6; Lethal Chr 7 Rinchik 6; OPI10; Protein Hikeshi; Uncharacterized protein C11orf73

Abbreviation

Recombinant Human C11orf73 protein

Gene Name

C11orf73

UniProt

Q53FT3

Expression Region

1-197aa

Organism

Homo sapiens (Human)

Target Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress

Molecular Weight

37.6 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGN 193109
TRC-A427040-50MG 50 mg

AGN 193109

Sign In for Pricing
View Details
Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL
BNC680205-500 1x 500 µL

Complement C4d (C4D205), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC Conjugated Rabbit Anti-UEA-I Antibody
FAL-2201-2 2 mL

FITC Conjugated Rabbit Anti-UEA-I Antibody

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF740 conjugate, 0.1mg/mL
BNC740729-100 1x 100 µL

Ku-Holo (p70;83) (KU729), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospholipase A2 (PLA2G4A) Human Gene Knockout Kit (CRISPR)
KN220972RB 1 Kit

Phospholipase A2 (PLA2G4A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1R,2S,5R)-(-)-Menthol-d4
TRC-M218877-2.5MG 2.5 mg

(1R,2S,5R)-(-)-Menthol-d4

Sign In for Pricing
View Details