Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf73 (C11orf73)

Product Specifications

Product Name Alternative

C11orf73; Chromosome 11 open reading frame 73; CK073_HUMAN; FLJ43020; Hikeshi; HSPC138; HSPC179; L7RN6; Lethal Chr 7 Rinchik 6; OPI10; Protein Hikeshi; Uncharacterized protein C11orf73

Abbreviation

Recombinant Human C11orf73 protein

Gene Name

C11orf73

UniProt

Q53FT3

Expression Region

1-197aa

Organism

Homo sapiens (Human)

Target Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress

Molecular Weight

37.6 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymine-d3
TRC-T412152-10MG 10 mg

Thymine-d3

Sign In for Pricing
View Details
MBD2 Rabbit Polyclonal Antibody
TA368060 100 µL

MBD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SSX4 (SSX4B) Human Gene Knockout Kit (CRISPR)
KN402758 1 Kit

SSX4 (SSX4B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HDAC4/HDAC5/HDAC9 pSer246/259/220 Rabbit Polyclonal Antibody
AP08035PU-N 100 µL

HDAC4/HDAC5/HDAC9 pSer246/259/220 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MELK Mouse Monoclonal Antibody [Clone ID: 2G2]
AM06778PU-N 100 µg

MELK Mouse Monoclonal Antibody [Clone ID: 2G2]

Sign In for Pricing
View Details
2,5-Pyridinedicarboxylic Acid
TRC-P991640-25G 25 g

2,5-Pyridinedicarboxylic Acid

Sign In for Pricing
View Details