Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Adiponectin (ADIPOQ)

Product Specifications

Product Name Alternative

30KDA adipocyte complement-related protein; Adipocyte complement-related 30KDA protein ; ACRP30Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein ; apM-1

Abbreviation

Recombinant Bovine ADIPOQ protein

Gene Name

ADIPOQ

UniProt

Q3Y5Z3

Expression Region

18-240aa

Organism

Bos taurus (Bovine)

Target Sequence

EDNMEDPPLPKGACAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDPGLVGPKGDTGETGITGIEGPRGFPGTPGRKGEPGESAYVYRSAFSVGLERQVTVPNVPIRFTKIFYNQQNHYDGTTGKFLCNIPGLYYFSYHITVYLKDVKVSLYKNDKALLFTHDQFQDKNVDQASGSVLLYLEKGDQVWLQVYEGENHNGVYADNVNDSTFTGFLLYHNIVE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue rodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW (By similarity) .

Molecular Weight

40.4 kDa

References & Citations

Identification and adipocyte differentiation-dependent expression of the unique disialic acid residue in an adipose tissue-specific glycoprotein, adipo Q.Sato C., Yasukawa Z., Honda N., Matsuda T., Kitajima K.J. Biol. Chem. 276:28849-28856 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cartilage
CS706916 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
MYCBP2 Recombinant Rabbit Monoclonal Antibody [PSH03-68]
HA722030 100 µL

MYCBP2 Recombinant Rabbit Monoclonal Antibody [PSH03-68]

Sign In for Pricing
View Details
DREF (ZBED1) (NM_001171135) Human Recombinant Protein
TP720555M 50 µg

DREF (ZBED1) (NM_001171135) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Papolb activation kit by CRISPRa
GA206017 1 Kit

Mouse Papolb activation kit by CRISPRa

Sign In for Pricing
View Details
Trimebutine Maleate Salt
TRC-T795605-5G 5 g

Trimebutine Maleate Salt

Sign In for Pricing
View Details
OGFOD2 Human Gene Knockout Kit (CRISPR)
KN420943 1 Kit

OGFOD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details