Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription initiation factor TFIID subunit 12 (TAF12)

Product Specifications

Product Name Alternative

Transcription initiation factor TFIID 20/15KDA subunits ; TAFII-20/TAFII-15 ; TAFII20/TAFII15

Abbreviation

Recombinant Human TAF12 protein

Gene Name

TAF12

UniProt

Q16514

Expression Region

1-161aa

Organism

Homo sapiens (Human)

Target Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC) . TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC) . TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.

Molecular Weight

33.9 kDa

References & Citations

A histone octamer-like structure within TFIID.Hoffmann A., Chiang C.M., Oelgeschlager T., Xie X., Burley S.K., Nakatani Y., Roeder R.G.Nature 380:356-359 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS802249 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
3,3-Diethoxypropionitrile
TRC-D442100-1G 1 g

3,3-Diethoxypropionitrile

Sign In for Pricing
View Details
ERG (C-term) Goat Polyclonal Antibody
AP07971PU-N 50 µg

ERG (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (HHV8/3606), 0.2mg/mL
BNUB3606-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (HHV8/3606), 0.2mg/mL

Sign In for Pricing
View Details
MYL12B (NM_001144944) Human Over-expression Lysate
LC428596 20 µg

MYL12B (NM_001144944) Human Over-expression Lysate

Sign In for Pricing
View Details
KLHL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C12]
TA501618AM 100 µL

KLHL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10C12]

Sign In for Pricing
View Details