Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6E (LY6E)

Product Specifications

Product Name Alternative

Retinoic acid-induced gene E protein Short name: RIG-E Stem cell antigen 2 Short name: SCA-2 Thymic shared antigen 1 Short name: TSA-1

Abbreviation

Recombinant Human LY6E protein

Gene Name

LY6E

UniProt

Q16553

Expression Region

21-101aa

Organism

Homo sapiens (Human)

Target Sequence

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in T-cell development. Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3

Molecular Weight

24.5 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Amino Flumequine
TRC-A392330-250MG 250 mg

8-Amino Flumequine

Sign In for Pricing
View Details
N-Palmitoyl-O-phosphocholine Serine-D9
TRC-P347921-5MG 5 mg

N-Palmitoyl-O-phosphocholine Serine-D9

Sign In for Pricing
View Details
Accuris™ Precision Balance, 120 grams, readability 0.001grams, 230V
W3200-120-E 1 Each

Accuris™ Precision Balance, 120 grams, readability 0.001grams, 230V

Sign In for Pricing
View Details
5,5-Diphenyl Hydantoin
TRC-D491650-5G 5 g

5,5-Diphenyl Hydantoin

Sign In for Pricing
View Details
ZFAND3 Rabbit Polyclonal Antibody
TA365172 100 µL

ZFAND3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CELSR2 Antibody
8C12183-AAT 50 µg

CELSR2 Antibody

Sign In for Pricing
View Details