Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial

Product Specifications

Product Name Alternative

TEA domain family member 4 ; TEAD-4Transcription factor 13-like 1Transcription factor RTEF-1

Abbreviation

Recombinant Human TEAD4 protein, partial

Gene Name

TEAD4

UniProt

Q15561

Expression Region

74-434aa

Organism

Homo sapiens (Human)

Target Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transcription

Relevance

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (T) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.

Molecular Weight

56.7 kDa

References & Citations

Structural basis of YAP recognition by TEAD4 in the hippo pathway.Chen L., Chan S.W., Zhang X., Walsh M., Lim C.J., Hong W., Song H.Genes Dev. 24:290-300 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester
264547-01 500 mg

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester
264547-02 1 g

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester
264547-03 2 g

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester
264547-04 5 g

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester
264547-05 10 g

3-Bromo-4-oxopiperidine-1-carboxylic acid tert-butyl ester

Sign In for Pricing
View Details
APOBEC3F, NT (APOBEC3F, DNA dC->dU-editing enzyme APOBEC-3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) (PE) discontinued
031983-PE 200 µL

APOBEC3F, NT (APOBEC3F, DNA dC->dU-editing enzyme APOBEC-3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F) (PE) discontinued

Sign In for Pricing
View Details