Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Luc7-like protein 3 (LUC7L3), partial

Product Specifications

Product Name Alternative

Cisplatin resistance-associated-overexpressed protein; Luc7AOkadaic acid-inducible phosphoprotein OA48-18cAMP regulatory element-associated protein 1 ; CRE-associated protein 1 ; CREAP-1

Abbreviation

Recombinant Human LUC7L3 protein, partial

Gene Name

LUC7L3

UniProt

O95232

Expression Region

1-79aa

Organism

Homo sapiens (Human)

Target Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

Molecular Weight

13.3 kDa

References & Citations

Identification of a family of DNA-binding proteins with homology to RNA splicing factors.Shipman K.L., Robinson P.J., King B.R., Smith R., Nicholson R.C.Biochem. Cell Biol. 84:9-19 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody
AP14369PU-N 400 µL

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565743 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
Anp32a Mouse Gene Knockout Kit (CRISPR)
KN501323 1 Kit

Anp32a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
9-cis-Retinyl Linoleate
TRC-R275300-1MG 1 mg

9-cis-Retinyl Linoleate

Sign In for Pricing
View Details
Recombinant Mouse SLAMF8 Protein (His Tag)
PKSM040579 100 µg

Recombinant Mouse SLAMF8 Protein (His Tag)

Sign In for Pricing
View Details
TTC1 Human Gene Knockout Kit (CRISPR)
KN401690 1 Kit

TTC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details