Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bis (5'-adenosyl) -triphosphatase (Fhit)

Product Specifications

Product Name Alternative

AP3A hydrolase ; AP3AaseDiadenosine 5',5'''-P1, P3-triphosphate hydrolaseDinucleosidetriphosphataseFragile histidine triad protein

Abbreviation

Recombinant Mouse Fhit protein

Gene Name

Fhit

UniProt

O89106

Expression Region

2-150aa

Organism

Mus musculus (Mouse)

Target Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity . Functions as tumor suppressor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity (By similarity) . Functions as tumor suppressor.

Molecular Weight

21.1 kDa

References & Citations

The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADSS polyclonal antibody
BS6316-01 50 µL

ADSS polyclonal antibody

Sign In for Pricing
View Details
ADSS polyclonal antibody
BS6316-02 100 µL

ADSS polyclonal antibody

Sign In for Pricing
View Details
ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3)
MBS6006538-01 0.1 mg

ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3)

Sign In for Pricing
View Details
ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3)
MBS6006538-02 5x 0.1 mg

ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger Protein 392, ZNF392, Zinc Finger Protein 435, ZNF435, dJ265C24.3)

Sign In for Pricing
View Details
FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)
MBS6227675-01 0.1 mL

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)

Sign In for Pricing
View Details
FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)
MBS6227675-02 5x 0.1 mL

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)

Sign In for Pricing
View Details