Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Bis (5'-adenosyl) -triphosphatase (Fhit)

Product Specifications

Product Name Alternative

AP3A hydrolase ; AP3AaseDiadenosine 5',5'''-P1, P3-triphosphate hydrolaseDinucleosidetriphosphataseFragile histidine triad protein

Abbreviation

Recombinant Mouse Fhit protein

Gene Name

Fhit

UniProt

O89106

Expression Region

2-150aa

Organism

Mus musculus (Mouse)

Target Sequence

SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity . Functions as tumor suppressor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cleaves P (1) -P (3) -bis (5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P (1) -P (4) -bis (5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P (1) -P (3) -bis (5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity (By similarity) . Functions as tumor suppressor.

Molecular Weight

21.1 kDa

References & Citations

The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Securin (PTTG1) Human Knockdown Lysate
LY300409 100 µg

Securin (PTTG1) Human Knockdown Lysate

Ask
View Details
Rabbit anti-PTPN22 Antibody
YLD6531-01 50 µL

Rabbit anti-PTPN22 Antibody

Ask
View Details
Rabbit anti-PTPN22 Antibody
YLD6531-02 100 µL

Rabbit anti-PTPN22 Antibody

Ask
View Details
Human GALNT1 Pre-designed siRNA Set B
SI006030B 1 Each

Human GALNT1 Pre-designed siRNA Set B

Ask
View Details
MPP1 (55kD Erythrocyte Membrane Protein, p55, Membrane Protein, Palmitoylated 1, DXS552E, EMP55) (MaxLight 405) discontinued
129812-ML405 100 µL

MPP1 (55kD Erythrocyte Membrane Protein, p55, Membrane Protein, Palmitoylated 1, DXS552E, EMP55) (MaxLight 405) discontinued

Ask
View Details
Human Recombinant Tau-381 (1N3R) Wild-Type Pre-formed Fibrils
B2022451 100 µg

Human Recombinant Tau-381 (1N3R) Wild-Type Pre-formed Fibrils

Ask
View Details