Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA (dsbA)

Product Specifications

Product Name Alternative

DsbA; PSPTO_0341Thiol:disulfide interchange protein DsbA

Abbreviation

Recombinant Pseudomonas syringae pv. tomato dsbA protein

Gene Name

DsbA

UniProt

O52376

Expression Region

23-214aa

Organism

Pseudomonas syringae pv. tomato (strain DC3000)

Target Sequence

AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins (By similarity) .

Molecular Weight

25.1 kDa

References & Citations

Kloek A.P., Kunkel B.N.The complete genome sequence of the Arabidopsis and tomato pathogen Pseudomonas syringae pv. tomato DC3000.Buell C.R., Joardar V., Lindeberg M., Selengut J., Paulsen I.T., Gwinn M.L., Dodson R.J., DeBoy R.T., Durkin A.S., Kolonay J.F., Madupu R., Daugherty S.C., Brinkac L.M., Beanan M.J., Haft D.H., Nelson W.C., Davidsen T.M., Zafar N. , Zhou L., Liu J., Yuan Q., Khouri H.M., Fedorova N.B., Tran B., Russell D., Berry K.J., Utterback T.R., Van Aken S.E., Feldblyum T.V., D'Ascenzo M., Deng W.-L., Ramos A.R., Alfano J.R., Cartinhour S., Chatterjee A.K., Delaney T.P., Lazarowitz S.G., Martin G.B., Schneider D.J., Tang X., Bender C.L., White O., Fraser C.M., Collmer A.Proc. Natl. Acad. Sci. U.S.A. 100:10181-10186 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Atp5k activation kit by CRISPRa
GA200331 1 Kit

Mouse Atp5k activation kit by CRISPRa

Sign In for Pricing
View Details
SERPINB5 Antibody
OC-635-01 50 μL

SERPINB5 Antibody

Sign In for Pricing
View Details
SERPINB5 Antibody
OC-635-02 100 µL

SERPINB5 Antibody

Sign In for Pricing
View Details
SERPINB5 Antibody
OC-635-03 1 mL

SERPINB5 Antibody

Sign In for Pricing
View Details
5'-O-(N-Tyrosyl)sulfamoyl-2-chloroadeonosine
TRC-T028385-50MG 50 mg

5'-O-(N-Tyrosyl)sulfamoyl-2-chloroadeonosine

Sign In for Pricing
View Details
PROP1 (NM_006261) Human Recombinant Protein
TP318746L 1 mg

PROP1 (NM_006261) Human Recombinant Protein

Sign In for Pricing
View Details