Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Scrapie-responsive protein 1 (Scrg1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Mouse Scrg1 protein

Gene Name

Scrg1

UniProt

O88745

Expression Region

21-98aa

Organism

Mus musculus (Mouse)

Target Sequence

MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25 kDa

References & Citations

Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNBP, ID (CNBP, RNF163, ZNF9, Cellular nucleic acid-binding protein, Zinc finger protein 9) (MaxLight 405) discontinued
034033-ML405 100 µL

CNBP, ID (CNBP, RNF163, ZNF9, Cellular nucleic acid-binding protein, Zinc finger protein 9) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Hetal Hemoglobin ELISA Kit
MBS016642 Inquire

Rabbit Hetal Hemoglobin ELISA Kit

Sign In for Pricing
View Details
Semaphorin 3C (SEMA3C) Antibody
abx101360-01 100 µL

Semaphorin 3C (SEMA3C) Antibody

Sign In for Pricing
View Details
Semaphorin 3C (SEMA3C) Antibody
abx101360-02 200 µL

Semaphorin 3C (SEMA3C) Antibody

Sign In for Pricing
View Details
Semaphorin 3C (SEMA3C) Antibody
abx101360-03 1 mL

Semaphorin 3C (SEMA3C) Antibody

Sign In for Pricing
View Details
Cyclin C (CCNC) Human Over-expression Lysate
orb1342754 100 µg

Cyclin C (CCNC) Human Over-expression Lysate

Sign In for Pricing
View Details