Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha

Product Specifications

Product Name Alternative

; Kunitz-type neurotoxin MitTx-alpha

Abbreviation

Recombinant Micrurus tener tener Kunitz-type neurotoxin MitTx-alpha protein

UniProt

G9I929

Expression Region

25-84aa

Organism

Micrurus tener tener (Texas coral snake)

Target Sequence

QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

This heterodimeric toxin potently activates mouse acid-sensing ion channel ASIC1/ACCN2 expressed in Xenopus oocytes. Both alternatively spliced isoforms ASIC1a and ASIC1b are activated, with a higher potency for ASIC1a (EC (50) =9.4 nM) vs ASIC1b (EC (50) =23 nM) . The ASIC3/ACCN3 subtype is also sensitive to the heterodimer, but with a lower potency (EC (50) =830 nM) . On ASIC2a/ACCN1, the toxin shows a very weak activation, but produces a rarkable potentiation (>100-fold) of protons when the Extracellular domain pH drops below neutrality. The toxin interacts with the Extracellular domain region of the channel, since responses are only observed in the outside-out configuration. In vivo, the heterodimer elicits robust pain-related behavior in mice by activation of ASIC1/ACCN2 channels on capsaicin-sensitive nerve fibers.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

MitTx, a heteromeric complex between Kunitz- and phospholipase-A2-like proteins, potently, persistently and selectively activates rat and chicken acid-sensing ion channel ASIC1

Molecular Weight

23.1 kDa

References & Citations

A heteromeric Texas coral snake toxin targets acid-sensing ion channels to produce pain.Bohlen C.J., Chesler A.T., Sharif-Naeini R., Medzihradszky K.F., Zhou S., King D., Sanchez E.E., Burlingame A.L., Basbaum A.I., Julius D.Nature 479:410-414 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat anti Bovine IgG (H + L) (HRP)
43C-CCB0113 2 mL

Goat anti Bovine IgG (H + L) (HRP)

Ask
View Details
TNIP1 Polyclonal Antibody
MBS2542870-01 0.02 mL

TNIP1 Polyclonal Antibody

Ask
View Details
TNIP1 Polyclonal Antibody
MBS2542870-02 0.06 mL

TNIP1 Polyclonal Antibody

Ask
View Details
TNIP1 Polyclonal Antibody
MBS2542870-03 0.12 mL

TNIP1 Polyclonal Antibody

Ask
View Details
TNIP1 Polyclonal Antibody
MBS2542870-04 0.2 mL

TNIP1 Polyclonal Antibody

Ask
View Details
TNIP1 Polyclonal Antibody
MBS2542870-05 5x 0.2 mL

TNIP1 Polyclonal Antibody

Ask
View Details