Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus Chromatin protein Cren7 (creN7)

Product Specifications

Product Name Alternative

CreN7; LS215_1335Chromatin protein Cren7

Abbreviation

Recombinant Sulfolobus islandicus creN7 protein

Gene Name

CreN7

UniProt

C3MPN0

Expression Region

1-60aa

Organism

Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)

Target Sequence

MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils.

Molecular Weight

33.6 kDa

References & Citations

Biogeography of the Sulfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL
BNC040705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL
BNC942221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL
BNC681506-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details